about-banner

Recombinant D. melanogaster Transcription initiation factor IIA subunit 1(TfIIA-L)

  • Catalog Number:  CDRPO-3110904
  • Size:   20 μg; 100 μg; 1000 μg

Target Information

Species

Drosophila melanogaster

Target Names

TfIIA-L

Alternative Names

TfIIA-L; CG5930; General transcription factor IIA subunit 1

Expression Region

263-366

Subcellular Location

Nucleus.

Protein Families

TFIIA subunit 1 family

Function

TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.

Database Info

KEGG: Dmel_CG5930; STRING: 7227.FBpp0084525; UniGene: Dm.3640

Product Details

Product Type

Recombinant Protein

Source

Yeast; E. coli; Baculovirus; Mammalian cell

Target Protein Sequence

DSSDEDESEESDDNIDNDDDDDLDKDDDEDAEHEDAAEEEPLNSEDDVTDEDSAEMFDTD NVIVCQYDKITRSRNKWKFYLKDGIMNMRGKDYVFQKSNGDAEW

Protein Length

Full Length of Mature Protein

Purity

>85% (SDS-PAGE)

Tag Info

The following tags are available. N-terminal His-tagged Tag-Free

Form

Lyophilized powder

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 °C/-80 °C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Lead Time

Delivery time may differ from different purchasing ways or locations, please kindly consult us for specific delivery times.

Storage & Handling

Storage Condition

Store at -20 °C/-80 °C upon receipt, aliquoting is necessary for multiple use.

Shelf Life

The shelf life is related to many factors, including storage state, buffer ingredients, storage temperature, and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 °C/-80 °C. The shelf life of lyophilized form is 12 months at -20 °C/-80 °C.

Handling

Repeated freezing and thawing are not recommended.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Store working aliquots at 4 °C for up to one week.

For research use only. Not intended for any clinical use.