about-banner

Recombinant D. melanogaster Partner of bursicon(pburs)

  • Catalog Number:  CDRPO-3110633
  • Size:   20 μg; 100 μg; 1000 μg

Target Information

Species

Drosophila melanogaster

Target Names

Pburs

Alternative Names

Pburs; burs-beta; CG15284; Partner of bursicon; Bursicon subunit beta

Expression Region

21-141aa

Subcellular Location

Secreted.

Function

Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk.

Database Info

KEGG: Dmel_CG15284; STRING: 7227.FBpp0080207; UniGene: Dm.26812

Product Details

Product Type

Recombinant Protein

Source

Yeast

Target Protein Sequence

LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Protein Length

Full Length of Mature Protein

Research Area

Others

Purity

>85% (SDS-PAGE)

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 °C/-80 °C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Lead Time

Delivery time may differ from different purchasing ways or locations, please kindly consult us for specific delivery times.

Storage & Handling

Storage Condition

Store at -20 °C/-80 °C upon receipt, aliquoting is necessary for multiple use.

Shelf Life

The shelf life is related to many factors, including storage state, buffer ingredients, storage temperature, and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 °C/-80 °C. The shelf life of lyophilized form is 12 months at -20 °C/-80 °C.

Handling

Repeated freezing and thawing are not recommended.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Store working aliquots at 4 °C for up to one week.

For research use only. Not intended for any clinical use.