Recombinant D. melanogaster Partner of bursicon(pburs)
- Catalog Number: CDRPO-3110632
- Size: 20 μg; 100 μg; 1000 μg
Target Information
Species | Drosophila melanogaster |
Target Names | Pburs |
Alternative Names | Pburs; burs-beta; CG15284; Partner of bursicon; Bursicon subunit beta |
Expression Region | 21-141aa |
Subcellular Location | Secreted. |
Function | Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk. |
Database Info | KEGG: Dmel_CG15284; STRING: 7227.FBpp0080207; UniGene: Dm.26812 |
Product Details
Product Type | Recombinant Protein |
Source | E. coli |
Target Protein Sequence | LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Protein Length | Full Length of Mature Protein |
Research Area | Others |
Purity | >85% (SDS-PAGE) |
Tag Info | N-terminal GST-tagged |
Form | Liquid or Lyophilized powder |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 °C/-80 °C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Lead Time | Delivery time may differ from different purchasing ways or locations, please kindly consult us for specific delivery times. |
Storage & Handling
Storage Condition | Store at -20 °C/-80 °C upon receipt, aliquoting is necessary for multiple use. |
Shelf Life | The shelf life is related to many factors, including storage state, buffer ingredients, storage temperature, and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 °C/-80 °C. The shelf life of lyophilized form is 12 months at -20 °C/-80 °C. |
Handling | Repeated freezing and thawing are not recommended. |
Limitations | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Store working aliquots at 4 °C for up to one week. |
For research use only. Not intended for any clinical use.