Recombinant D. melanogaster Dopamine receptor 1(DopR), partial

Drosophila melanogaster

Dop1R1

Dop1R1; DopR; DopR1; DopR35EF; CG9652; Dopamine receptor 1; D-DOP1; DmDop1; dDA1; Dopamine 1-like receptor 1

20-142aa

Cell membrane; Multi-pass membrane protein.

G-protein coupled receptor 1 family

Receptor for dopamine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Might be involved in the processing of visual information and/or visual learning. Important for Pavlovian conditioning: required in the mushroom body as a receptor conveying unconditional stimuli information, has a role in memory formation for aversive and appetitive learning. Sleep-deprivation-induced impairments in learning can be partially explained through alterations in dopamine signaling, Dop1R1 expression levels are reduced; sleep may have a role in restoring dopamine homeostasis.

KEGG: Dmel_CG9652; STRING: 7227.FBpp0303554; UniGene: Dm.3077

Recombinant Protein

Yeast; E. coli; Baculovirus; Mammalian cell

MRAIAAIAAGVGSVAATVATSTTSSISSSTTIINTSSATTIGGNHTSGSTGFSTNSTLLD ADHLPLQLTTAKVDLDIEIDIQLLTNGYDGTTLTSFYNESSWTNASEMDTIVGEEPEPLS LVS

Partial

>85% (SDS-PAGE)

The following tags are available. N-terminal His-tagged Tag-Free

Lyophilized powder

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 °C/-80 °C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Delivery time may differ from different purchasing ways or locations, please kindly consult us for specific delivery times.

Store at -20 °C/-80 °C upon receipt, aliquoting is necessary for multiple use.

The shelf life is related to many factors, including storage state, buffer ingredients, storage temperature, and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 °C/-80 °C. The shelf life of lyophilized form is 12 months at -20 °C/-80 °C.

Repeated freezing and thawing are not recommended.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Store working aliquots at 4 °C for up to one week.