Recombinant D. melanogaster DNA-directed RNA polymerase II subunit RPB1(RpII215), partial
- Catalog Number: CDRPO-3110747
- Size: 20 μg; 100 μg; 1000 μg
Target Information
Species | Drosophila melanogaster |
Target Names | RpII215 |
Alternative Names | RpII215; CG1554; DNA-directed RNA polymerase II subunit RPB1; RNA polymerase II subunit B1; EC 2.7.7.6; DNA-directed RNA polymerase III largest subunit |
Expression Region | 1579-1881aa |
Subcellular Location | Nucleus. |
Protein Families | RNA polymerase beta' chain family |
Function | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Forms the polymerase active center together with the second largest subunit. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB1 is part of the core element with the central large cleft, the clamp element that moves to open and close the cleft and the jaws that are thought to grab the incoming DNA template. At the start of transcription, a single-stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol II. A bridging helix emanates from RPB1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol II by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. During transcription elongation, Pol II moves on the template as the transcript elongates. Elongation is influenced by the phosphorylation status of the C-terminal domain (CTD) of Pol II largest subunit (RPB1), which serves as a platform for assembly of factors that regulate transcription initiation, elongation, termination and mRNA processing. |
Database Info | KEGG: Dmel_CG1554; STRING: 7227.FBpp0073387; UniGene: Dm.2925 |
Product Details
Product Type | Recombinant Protein |
Source | Yeast |
Target Protein Sequence | YSPTSPNYTASSPGGASPNYSPSSPNYSPTSPLYASPRYASTTPNFNPQSTGYSPSSSGYSPTSPVYSPTVQFQSSPSFAGSGSNIYSPGNAYSPSSSNYSPNSPSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSPNYSASPQYSPASPAYSQTGVKYSPTSPTYSPPSPSYDGSPGSPQYTPGSPQYSPASPKYSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPRYSPNMSIYSPSSTKYSPTSPTYTPTARNYSPTSPMYSPTAPSHYSPTSPAYSPSSPT Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Protein Length | Partial |
Research Area | Others |
Purity | >85% (SDS-PAGE) |
Tag Info | N-terminal 6xHis-tagged |
Form | Liquid or Lyophilized powder |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 °C/-80 °C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Lead Time | Delivery time may differ from different purchasing ways or locations, please kindly consult us for specific delivery times. |
Storage & Handling
Storage Condition | Store at -20 °C/-80 °C upon receipt, aliquoting is necessary for multiple use. |
Shelf Life | The shelf life is related to many factors, including storage state, buffer ingredients, storage temperature, and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 °C/-80 °C. The shelf life of lyophilized form is 12 months at -20 °C/-80 °C. |
Handling | Repeated freezing and thawing are not recommended. |
Limitations | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Store working aliquots at 4 °C for up to one week. |
For research use only. Not intended for any clinical use.