Anti-D. melanogaster WDR68 Polyclonal Antibody
- Catalog Number: CDDMAB-3121042
- Size: 100 μL; 50 μL; More Options
Target Information
| Target Names | DCAF7 |
| Function | WDR68 is involved in craniofacial development. Acts upstream of the EDN1 pathway and is required for formation of theupper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the firstand second arches . |
Product Details
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Conjugate | Non-conjugated |
| Purification Method | Immunogen affinity purified |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNC. |
| Form | Liquid |
| Buffer | PBS (pH 7.2), 40% Glycerol |
Usage
| Applications | WB, ICC/IF, IHC, IHC-P |
| Species Reactivity | Drosophila melanogaster |
Storage & Handling
| Storage Temp. | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
| Limitations | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. |
For research use only. Not intended for any clinical use.