Anti-D. melanogaster SNRPD2 Polyclonal Antibody
- Catalog Number: CDDMAB-3120973
- Size: 100 μL; 50 μL; More Options
Target Information
Target Names | SNRPD2 |
Function | The protein encoded by the SNRPD2 gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq) |
Product Details
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Conjugate | Non-conjugated |
Purification Method | Immunogen affinity purified |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: REEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTE. |
Form | Liquid |
Buffer | PBS (pH 7.2), 40% Glycerol |
Availability | Made-to-order |
Usage
Applications | WB, ICC/IF, IHC, IHC-P |
Species Reactivity | Drosophila melanogaster |
Storage & Handling
Storage Temp. | Store at -20 °C or -80 °C. |
Handling | Avoid freeze-thaw cycles. |
Limitations | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. |
For research use only. Not intended for any clinical use.