Anti-D. melanogaster Segmentation protein even-skipped Polyclonal Antibody
Online
Inquiry
- Catalog Number: CDDMAB-3121155
- Size: 100 μL; 50 μL; More Options
Target Information
Target Names | eve |
Gene ID |
Product Details
Host | Rabbit |
Clonality | Polyclonal |
Conjugate | Non-conjugated |
Purification Method | Affinity purified |
Immunogen | The immunogen is a synthetic peptide corresponding to a region of Drosophila melanogaster (NP_523670). Peptide sequence MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS. |
Form | Liquid |
Buffer | PBS buffer, 2% sucrose. |
Usage
Applications | WB |
Species Reactivity | Drosophila melanogaster |
Storage & Handling
Storage Temp. | Store at -20 °C or -80 °C. |
Handling | Avoid freeze-thaw cycles. |
Limitations | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. |
For research use only. Not intended for any clinical use.