Anti-D. melanogaster MTTP Polyclonal Antibody
- Catalog Number: CDDMAB-3120655
- Size: 100 μL; 50 μL; More Options
Target Information
| Target Names | MTTP |
| Function | MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia. |
Product Details
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Conjugate | Non-conjugated |
| Purification Method | Immunogen affinity purified |
| Immunogen | Synthetic peptide directed towards the N terminal of human MTTP (NP_000244). Peptide sequence within the following region: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK. The peptide sequence for this immunogen was taken from within the described region. |
| Form | Liquid |
| Buffer | PBS, 2% Sucrose |
| Concentration | It differs from different batches. Please contact us to confirm it. |
Usage
| Applications | WB |
| Species Reactivity | Drosophila melanogaster |
Storage & Handling
| Storage Temp. | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
| Limitations | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. |
For research use only. Not intended for any clinical use.