Anti-D. melanogaster Epsilon 1 Tubulin Polyclonal Antibody
- Catalog Number: CDDMAB-3120981
- Size: 100 μL; 50 μL; More Options
Target Information
| Target Names | TUBE1 |
| Function | This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication. This protein plays a central role in organization |
Product Details
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Conjugate | Non-conjugated |
| Purification Method | Immunogen affinity purified |
| Immunogen | Synthetic peptides corresponding to TUBE1(tubulin, epsilon 1) The peptide sequence was selected from the middle region of TUBE1. Peptide sequence HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA. The peptide sequence for this immunogen was taken from within the described region. |
| Form | Liquid |
| Buffer | PBS, 2% Sucrose |
| Concentration | It differs from different batches. Please contact us to confirm it. |
Usage
| Applications | WB, IHC, IHC-P |
| Species Reactivity | Drosophila melanogaster |
Storage & Handling
| Storage Temp. | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
| Limitations | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. |
For research use only. Not intended for any clinical use.